| Name | ANKRD42 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4932 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW |
| Purity/Format | Affinity purified |
| Blocking Peptide | ANKRD42 Blocking Peptide |
| Description | Rabbit polyclonal ANKRD42 antibody raised against the N terminal of ANKRD42 |
| Gene | ANKRD42 |
| Supplier Page | Shop |