ABCD3 antibody

Name ABCD3 antibody
Supplier Fitzgerald
Catalog 70R-7348
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD
Purity/Format Affinity purified
Blocking Peptide ABCD3 Blocking Peptide
Description Rabbit polyclonal ABCD3 antibody
Gene ABCD3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.