| Name | G6PC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6258 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
| Purity/Format | Affinity purified |
| Blocking Peptide | G6PC Blocking Peptide |
| Description | Rabbit polyclonal G6PC antibody raised against the N terminal of G6PC |
| Gene | G6PC |
| Supplier Page | Shop |