| Name | FAAH2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7541 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAAH2 Blocking Peptide |
| Description | Rabbit polyclonal FAAH2 antibody raised against the C terminal of FAAH2 |
| Gene | FAAH2 |
| Supplier Page | Shop |