OAT antibody

Name OAT antibody
Supplier Fitzgerald
Catalog 70R-5318
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV
Purity/Format Affinity purified
Blocking Peptide OAT Blocking Peptide
Description Rabbit polyclonal OAT antibody
Gene OAT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.