| Name | DLG7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2401 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG |
| Purity/Format | Affinity purified |
| Blocking Peptide | DLG7 Blocking Peptide |
| Description | Rabbit polyclonal DLG7 antibody raised against the N terminal Of Dlg7 |
| Gene | DLG1 |
| Supplier Page | Shop |