| Name | TMEM93 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6642 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM93 Blocking Peptide |
| Description | Rabbit polyclonal TMEM93 antibody raised against the N terminal of TMEM93 |
| Gene | EMC6 |
| Supplier Page | Shop |