| Name | TTC35 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4420 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TTC35 antibody was raised using the middle region of TTC35 corresponding to a region with amino acids IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE |
| Purity/Format | Affinity purified |
| Blocking Peptide | TTC35 Blocking Peptide |
| Description | Rabbit polyclonal TTC35 antibody raised against the middle region of TTC35 |
| Gene | EMC2 |
| Supplier Page | Shop |