| Name | FBXW2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2786 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI |
| Purity/Format | Affinity purified |
| Blocking Peptide | FBXW2 Blocking Peptide |
| Description | Rabbit polyclonal FBXW2 antibody raised against the middle region of FBXW2 |
| Gene | FBXW2 |
| Supplier Page | Shop |