Name | FAM134B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6834 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM134B antibody was raised using the middle region of FAM134B corresponding to a region with amino acids DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV |
Purity/Format | Affinity purified |
Blocking Peptide | FAM134B Blocking Peptide |
Description | Rabbit polyclonal FAM134B antibody raised against the middle region of FAM134B |
Gene | FAM134B |
Supplier Page | Shop |