| Name | BCHE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1889 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | BCHE Blocking Peptide |
| Description | Rabbit polyclonal BCHE antibody raised against the N terminal of BCHE |
| Gene | BCHE |
| Supplier Page | Shop |