SEC14L4 antibody

Name SEC14L4 antibody
Supplier Fitzgerald
Catalog 70R-3716
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen SEC14L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ
Purity/Format Affinity purified
Blocking Peptide SEC14L4 Blocking Peptide
Description Rabbit polyclonal SEC14L4 antibody
Gene SEC14L4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.