UPP1 antibody

Name UPP1 antibody
Supplier Fitzgerald
Catalog 70R-3171
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen UPP1 antibody was raised using the middle region of UPP1 corresponding to a region with amino acids ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
Purity/Format Affinity purified
Blocking Peptide UPP1 Blocking Peptide
Description Rabbit polyclonal UPP1 antibody raised against the middle region of UPP1
Gene UPP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.