CSTF2T antibody

• Supplier: Fitzgerald
• Catalog: 70R-4996
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT
• Purity/Format: Affinity purified
• Blocking Peptide: CSTF2T Blocking Peptide
• Description: Rabbit polyclonal CSTF2T antibody raised against the C terminal of CSTF2T
• Gene: CSTF2T