Name | GDAP2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4452 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids SSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRF |
Purity/Format | Affinity purified |
Blocking Peptide | GDAP2 Blocking Peptide |
Description | Rabbit polyclonal GDAP2 antibody raised against the N terminal of GDAP2 |
Gene | GDAP2 |
Supplier Page | Shop |