CDH12 antibody

Name CDH12 antibody
Supplier Fitzgerald
Catalog 70R-6130
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI
Purity/Format Affinity purified
Blocking Peptide CDH12 Blocking Peptide
Description Rabbit polyclonal CDH12 antibody
Gene CDH12
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.