| Name | FAIM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3010 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAIM antibody was raised using the N terminal of FAIM corresponding to a region with amino acids MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAIM Blocking Peptide |
| Description | Rabbit polyclonal FAIM antibody raised against the N terminal of FAIM |
| Gene | FAIM |
| Supplier Page | Shop |