HNRPLL antibody

Name HNRPLL antibody
Supplier Fitzgerald
Catalog 70R-4841
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG
Purity/Format Affinity purified
Blocking Peptide HNRPLL Blocking Peptide
Description Rabbit polyclonal HNRPLL antibody raised against the N terminal of HNRPLL
Gene HNRNPLL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.