Name | HNRPLL antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4841 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG |
Purity/Format | Affinity purified |
Blocking Peptide | HNRPLL Blocking Peptide |
Description | Rabbit polyclonal HNRPLL antibody raised against the N terminal of HNRPLL |
Gene | HNRNPLL |
Supplier Page | Shop |