Name | HSPA4L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3945 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI |
Purity/Format | Affinity purified |
Blocking Peptide | HSPA4L Blocking Peptide |
Description | Rabbit polyclonal HSPA4L antibody raised against the C terminal of HSPA4L |
Gene | HSPA4 |
Supplier Page | Shop |