| Name | HSPA4L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3945 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI |
| Purity/Format | Affinity purified |
| Blocking Peptide | HSPA4L Blocking Peptide |
| Description | Rabbit polyclonal HSPA4L antibody raised against the C terminal of HSPA4L |
| Gene | HSPA4 |
| Supplier Page | Shop |