| Name | NOSIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2310 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NOSIP antibody was raised using the N terminal of NOSIP corresponding to a region with amino acids LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | NOSIP Blocking Peptide |
| Description | Rabbit polyclonal NOSIP antibody raised against the N terminal of NOSIP |
| Gene | NOSIP |
| Supplier Page | Shop |