| Name | ATL3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5965 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ATL3 antibody was raised using the middle region of Dkfzp564J0863 corresponding to a region with amino acids IYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSF |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATL3 Blocking Peptide |
| Description | Rabbit polyclonal ATL3 antibody raised against the middle region of Dkfzp564J0863 |
| Gene | ATL3 |
| Supplier Page | Shop |