Name | HSPA4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3047 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Dog |
Antigen | HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS |
Purity/Format | Affinity purified |
Blocking Peptide | HSPA4 Blocking Peptide |
Description | Rabbit polyclonal HSPA4 antibody raised against the N terminal of HSPA4 |
Gene | HSPA4 |
Supplier Page | Shop |