| Name | DENND2C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3785 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DENND2C antibody was raised using the middle region of DENND2C corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL |
| Purity/Format | Affinity purified |
| Blocking Peptide | DENND2C Blocking Peptide |
| Description | Rabbit polyclonal DENND2C antibody raised against the middle region of DENND2C |
| Gene | DENND2C |
| Supplier Page | Shop |