Name | UGT1A1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7289 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | UGT1A1 antibody was raised using the N terminal of UGT1A1 corresponding to a region with amino acids DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR |
Purity/Format | Affinity purified |
Blocking Peptide | UGT1A1 Blocking Peptide |
Description | Rabbit polyclonal UGT1A1 antibody raised against the N terminal of UGT1A1 |
Gene | UGT1A |
Supplier Page | Shop |