LONRF2 antibody

Name LONRF2 antibody
Supplier Fitzgerald
Catalog 70R-6199
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR
Purity/Format Affinity purified
Blocking Peptide LONRF2 Blocking Peptide
Description Rabbit polyclonal LONRF2 antibody raised against the middle region of LONRF2
Gene LONRF2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.