| Name | SEMA4B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7129 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SEMA4B antibody was raised using the N terminal of SEMA4B corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS |
| Purity/Format | Affinity purified |
| Blocking Peptide | SEMA4B Blocking Peptide |
| Description | Rabbit polyclonal SEMA4B antibody raised against the N terminal of SEMA4B |
| Gene | SEMA4B |
| Supplier Page | Shop |