Name | RPS21 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2535 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF |
Purity/Format | Affinity purified |
Blocking Peptide | RPS21 Blocking Peptide |
Description | Rabbit polyclonal RPS21 antibody raised against the N terminal of RPS21 |
Gene | RPS21 |
Supplier Page | Shop |