| Name | RHBG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7321 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RHBG antibody was raised using the C terminal of RHBG corresponding to a region with amino acids LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHBG Blocking Peptide |
| Description | Rabbit polyclonal RHBG antibody raised against the C terminal of RHBG |
| Gene | RHBG |
| Supplier Page | Shop |