IL13RA2 antibody

Name IL13RA2 antibody
Supplier Fitzgerald
Catalog 70R-7514
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen IL13RA2 antibody was raised using the middle region of IL13RA2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
Purity/Format Affinity purified
Blocking Peptide IL13RA2 Blocking Peptide
Description Rabbit polyclonal IL13RA2 antibody raised against the middle region of IL13RA2
Gene IL13RA2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.