GABRE antibody

Name GABRE antibody
Supplier Fitzgerald
Catalog 70R-5193
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV
Purity/Format Affinity purified
Blocking Peptide GABRE Blocking Peptide
Description Rabbit polyclonal GABRE antibody
Gene GABRE
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.