| Name | C13orf30 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4041 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C13orf30 antibody was raised using the N terminal of C13orf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY |
| Purity/Format | Affinity purified |
| Blocking Peptide | C13orf30 Blocking Peptide |
| Description | Rabbit polyclonal C13orf30 antibody raised against the N terminal of C13orf30 |
| Gene | FAM216B |
| Supplier Page | Shop |