| Name | FYN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5867 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FYN antibody was raised using the middle region of FYN corresponding to a region with amino acids CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN |
| Purity/Format | Affinity purified |
| Blocking Peptide | FYN Blocking Peptide |
| Description | Rabbit polyclonal FYN antibody raised against the middle region of FYN |
| Gene | SLK |
| Supplier Page | Shop |