| Name | UGT1A6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7546 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | UGT1A6 antibody was raised using the C terminal of UGT1A6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK |
| Purity/Format | Affinity purified |
| Blocking Peptide | UGT1A6 Blocking Peptide |
| Description | Rabbit polyclonal UGT1A6 antibody raised against the C terminal of UGT1A6 |
| Gene | UGT1A8 |
| Supplier Page | Shop |