Carbonic Anhydrase IV antibody

• Supplier: Fitzgerald
• Catalog: 70R-1862
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: Carbonic Anhydrase IV Blocking Peptide
• Description: Rabbit polyclonal Carbonic Anhydrase IV antibody raised against the middle region of CA4
• Gene: CA4