TMTC4 antibody

Name TMTC4 antibody
Supplier Fitzgerald
Catalog 70R-6839
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF
Purity/Format Affinity purified
Blocking Peptide TMTC4 Blocking Peptide
Description Rabbit polyclonal TMTC4 antibody raised against the N terminal of TMTC4
Gene TMTC4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.