| Name | C16ORF65 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4265 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C16ORF65 antibody was raised using the middle region of C16Orf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI |
| Purity/Format | Affinity purified |
| Blocking Peptide | C16ORF65 Blocking Peptide |
| Description | Rabbit polyclonal C16ORF65 antibody raised against the middle region of C16Orf65 |
| Gene | PDZD9 |
| Supplier Page | Shop |