Tetraspanin 17 antibody

• Supplier: Fitzgerald
• Catalog: 70R-6679
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat
• Antigen: Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI
• Purity/Format: Affinity purified
• Blocking Peptide: Tetraspanin 17 Blocking Peptide
• Description: Rabbit polyclonal Tetraspanin 17 antibody raised against the N terminal of TSPAN17
• Gene: TSPAN17