| Name | C19ORF56 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6876 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C19ORF56 antibody was raised using the N terminal Of C19Orf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML |
| Purity/Format | Affinity purified |
| Blocking Peptide | C19ORF56 Blocking Peptide |
| Description | Rabbit polyclonal C19ORF56 antibody raised against the N terminal Of C19Orf56 |
| Gene | WDR83OS |
| Supplier Page | Shop |