| Name | PCYT2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1192 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PCYT2 Blocking Peptide |
| Description | Rabbit polyclonal PCYT2 antibody raised against the C terminal of PCYT2 |
| Gene | PCYT2 |
| Supplier Page | Shop |