| Name | C14ORF172 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2828 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C14ORF172 antibody was raised using the N terminal Of C14Orf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI |
| Purity/Format | Affinity purified |
| Blocking Peptide | C14ORF172 Blocking Peptide |
| Description | Rabbit polyclonal C14ORF172 antibody raised against the N terminal Of C14Orf172 |
| Gene | TRMT61A |
| Supplier Page | Shop |