| Name | C5ORF4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7070 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | C5ORF4 antibody was raised using the N terminal Of C5Orf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | C5ORF4 Blocking Peptide |
| Description | Rabbit polyclonal C5ORF4 antibody raised against the N terminal Of C5Orf4 |
| Gene | FAXDC2 |
| Supplier Page | Shop |