| Name | FAM134A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6908 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM134A antibody was raised using the N terminal of FAM134A corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM134A Blocking Peptide |
| Description | Rabbit polyclonal FAM134A antibody raised against the N terminal of FAM134A |
| Gene | FAM134A |
| Supplier Page | Shop |