CSH2 antibody

Name CSH2 antibody
Supplier Fitzgerald
Catalog 70R-4526
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CSH2 antibody was raised using the middle region of CSH2 corresponding to a region with amino acids LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH
Purity/Format Affinity purified
Blocking Peptide CSH2 Blocking Peptide
Description Rabbit polyclonal CSH2 antibody raised against the middle region of CSH2
Gene CSH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.