| Name | ACSL5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6556 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ACSL5 antibody was raised using the C terminal of ACSL5 corresponding to a region with amino acids ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACSL5 Blocking Peptide |
| Description | Rabbit polyclonal ACSL5 antibody raised against the C terminal of ACSL5 |
| Gene | ACSL6 |
| Supplier Page | Shop |