| Name | GTPBP9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1417 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | GTPBP9 Blocking Peptide |
| Description | Rabbit polyclonal GTPBP9 antibody |
| Gene | OLA1 |
| Supplier Page | Shop |