CYP3A7 antibody

• Supplier: Fitzgerald
• Catalog: 70R-1867
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: CYP3A7 Blocking Peptide
• Description: Rabbit polyclonal CYP3A7 antibody raised against the middle region of CYP3A7
• Gene: CYP3A7