ODF4 antibody

Name ODF4 antibody
Supplier Fitzgerald
Catalog 70R-6941
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL
Purity/Format Affinity purified
Blocking Peptide ODF4 Blocking Peptide
Description Rabbit polyclonal ODF4 antibody raised against the N terminal of ODF4
Gene ODF4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.