| Name | MGC87631 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4558 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MGC87631 antibody was raised using the middle region of MGC87631 corresponding to a region with amino acids VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV |
| Purity/Format | Affinity purified |
| Blocking Peptide | MGC87631 Blocking Peptide |
| Description | Rabbit polyclonal MGC87631 antibody raised against the middle region of MGC87631 |
| Gene | CCDC144NL |
| Supplier Page | Shop |