| Name | HAMP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6236 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM |
| Purity/Format | Affinity purified |
| Blocking Peptide | HAMP Blocking Peptide |
| Description | Rabbit polyclonal HAMP antibody raised against the N terminal of HAMP |
| Gene | HAMP |
| Supplier Page | Shop |