S100A3 antibody

Name S100A3 antibody
Supplier Fitzgerald
Catalog 70R-1096
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen S100A3 antibody was raised using the N terminal of S100A3 corresponding to a region with amino acids MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF
Purity/Format Total IgG Protein A purified
Blocking Peptide S100A3 Blocking Peptide
Description Rabbit polyclonal S100A3 antibody raised against the N terminal of S100A3
Gene S100B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.